Protein Info for Shewana3_0676 in Shewanella sp. ANA-3

Annotation: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR01670: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family" amino acids 21 to 174 (154 residues), 190.1 bits, see alignment E=1.1e-60 PF13419: HAD_2" amino acids 58 to 126 (69 residues), 28.2 bits, see alignment E=1.9e-10 PF08282: Hydrolase_3" amino acids 90 to 161 (72 residues), 39.3 bits, see alignment E=6.5e-14

Best Hits

Swiss-Prot: 59% identical to KDSC_YERPE: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (kdsC) from Yersinia pestis

KEGG orthology group: K03270, 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC: 3.1.3.45] (inferred from 98% identity to shm:Shewmr7_3345)

MetaCyc: 56% identical to 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase monomer (Escherichia coli BL21(DE3))
3-deoxy-manno-octulosonate-8-phosphatase. [EC: 3.1.3.45]

Predicted SEED Role

"3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45)" in subsystem KDO2-Lipid A biosynthesis (EC 3.1.3.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSZ5 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Shewana3_0676 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (RefSeq) (Shewanella sp. ANA-3)
MPQQGFYGPISDDVWQRAQKIKLLICDVDGVFSDGRIYLSNAGEELKAFHTRDGYGVRSL
LTSGFNLAVITGRQSKIVENRMTALGVTHIYQGVDNKFVPYEELLSLYNVTPEEVAYIGD
DIVDLPVMNVVGLAVCVADGHPYVRQHAHFVTHLNGGHGALRELTDLLLLSQNKFTSAHG
MSI