Protein Info for Shewana3_0666 in Shewanella sp. ANA-3

Annotation: molybdate ABC transporter periplasmic molybdate-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13531: SBP_bac_11" amino acids 36 to 271 (236 residues), 170 bits, see alignment E=3.5e-54 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 39 to 164 (126 residues), 68.5 bits, see alignment E=3.9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0666)

Predicted SEED Role

"Molybdenum-binding periplasmic protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSY5 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Shewana3_0666 molybdate ABC transporter periplasmic molybdate-binding protein (RefSeq) (Shewanella sp. ANA-3)
MAKQGLVLAISLGSTLMAGMVQGAPTSAEVTTPIELRAAGSLKAAMNDIIAAYQAKSDAK
VAAQYAPSGLLLKRIQEGERVDIFASANMKHPQALVDAGAGQQVQMFARNQLCAIALADV
PLTSANLLDTLLAPQIKLGTSTPKADPAGDYAWAVFAKAEALKANAKTTLETKALQLTGG
PESAKPPKDRNPYAWVMENKLADVFLTYCTNAVLAQKEVPSLKIVDLPPELAVGADYGLL
VLKDANSAAAPLAEFILSPDGQAILTGYGFQPPKK