Protein Info for Shewana3_0654 in Shewanella sp. ANA-3

Annotation: Mg2 transporter protein, CorA family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 265 to 287 (23 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details PF01544: CorA" amino acids 36 to 321 (286 residues), 221 bits, see alignment E=1.1e-69

Best Hits

Swiss-Prot: 36% identical to ZNTB_YERE8: Zinc transport protein ZntB (zntB) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to shn:Shewana3_0654)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSX3 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Shewana3_0654 Mg2 transporter protein, CorA family protein (RefSeq) (Shewanella sp. ANA-3)
MECDMHDGFIYSLVLSGARAGSTLTPEELENWDPNDGLIWIHLRYRHKKARHWVLNSGLN
KVESDALLAQDTRPRAVLAGEGVLLALRGVNLNPNSAPEDMVAVRIYADKQRIISTCDRE
LLSVKDVAELIMEGAGPTTTGDFIVAVCERLTTRKVDFIDTLEEQLSELEEQVVSGNVKD
LRTDIAELRRQTVALRRYLGPQKEAYAKMLSDQFVLFNEPERLKMRETTDKLIRTIEDLD
ALRDRANVTQEELLSQQSEQLNKRLYFLSLVSAIFLPLGFLTGLLGVNIGGIPGADNTWA
FATFCGILISLVALQMALFYRFKWL