Protein Info for Shewana3_0618 in Shewanella sp. ANA-3

Annotation: Sel1 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF08238: Sel1" amino acids 51 to 86 (36 residues), 22.8 bits, see alignment 5.3e-09 amino acids 93 to 115 (23 residues), 9.7 bits, see alignment (E = 7.6e-05) amino acids 125 to 149 (25 residues), 10.3 bits, see alignment (E = 4.8e-05)

Best Hits

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_0619)

Predicted SEED Role

"Sel1 domain protein repeat-containing protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KST8 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Shewana3_0618 Sel1 domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MKYRQWVLGAGFTLSLGMSAAAHAFSIPQPANEVAASKFVHIQVQAEQGDADAQFLLGLM
FLSGRYVQQEVPTGLHWMTLAAEQQHEKAQQTLADLSFEGQLVKRDLAVAERWYKDMGER
GNRWAQFRLGFIYASGGDGIARNCGKAVEQFTRVGDDVALGNVAWILATCPEAEYRDGNK
ALELSLQLLKVNENDPTNLDNLAAAYAEVGDFGAAVSTQQKAIAALKMTAEATKTDEFQQ
RLHSYEQKRAYRETLRLLD