Protein Info for Shewana3_0607 in Shewanella sp. ANA-3

Annotation: peptidase S9 prolyl oligopeptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 826 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00930: DPPIV_N" amino acids 377 to 535 (159 residues), 61.8 bits, see alignment E=1.2e-20 PF02129: Peptidase_S15" amino acids 582 to 727 (146 residues), 42.1 bits, see alignment E=2.3e-14 PF20434: BD-FAE" amino acids 594 to 705 (112 residues), 37.5 bits, see alignment E=4.7e-13 PF00326: Peptidase_S9" amino acids 630 to 825 (196 residues), 162.5 bits, see alignment E=2.6e-51 PF01738: DLH" amino acids 632 to 809 (178 residues), 23.7 bits, see alignment E=8.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0607)

Predicted SEED Role

"Dipeptidyl peptidase IV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSS7 at UniProt or InterPro

Protein Sequence (826 amino acids)

>Shewana3_0607 peptidase S9 prolyl oligopeptidase (RefSeq) (Shewanella sp. ANA-3)
MNSVMRNLGLSALAVAVLTSCAATSTETATPATTPQAYQVPLALPPQVSQSLTLNQIMAN
PDWMGIFAKEAYWSDDSQSVFFARQPSASPLRNYYQQGINDSRAVELAIDKLHAADQQFG
VLDSAKANKAYLYQGNIFVKHLSSGKITQLTRQRTAISGLRYLNNGDIAYWQGDNVFQIH
QDSGLVEQLAEIKMAKAPEGVKEPSSYLAKQQHRLIQYVALQQENAKAKEQFKNELQKSD
PTLAANTWYLGDAEVVSELSLSPDGRYLFVALTDKNYTGSSEHDIMPNYLGSEGYIDPVP
VRARVAEDTPPGQRFVVLDLNEHKQIDVTIEGLTGFDEDVLAKVKTENAKAKGESYQSTK
APRKIQLMQDWGWTQSAIQWHESEDKLAVMVEATDNKDRWIASVDLAKGKFITEHRLHDD
AWVNYDYNQFGWLPGTDALYYLSEETGYSQLYIKARGEKPRALTQGKFVVSDITLSPDAN
YIYYKANQSHPGIYNVHRVNIASGKNEQLTQWDGNLDYSLSPDGTKLLLNASRRTEPNEL
YVQPIGGELKQLTSYTSDAFKQYPWQAPEVVAVPSNHGAGQVYARVYLPQGYDKSRAEKY
PAVIFNHGAGYLQNADYGFSGYFREFMFHNLLTQQGYVVMDMDYRGSKGYGRDWRTAIYR
NMGHPEVEDLKDGVTWMGQNANVDIKRVGTYGGSYGGFLTFMSLFTEPELFQAGAALRPV
ADWAHYNAPYTSNILNTPDVDPIAYERSSPIEHAQGLTKPLLIMSGVMDDNVFFQDSVRM
VQHLIELEKPMFETAIYPVEPHGFRQPSSWLDEYRRIYKLFEQELK