Protein Info for Shewana3_0606 in Shewanella sp. ANA-3

Annotation: aminodeoxychorismate synthase, glutamine amidotransferase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 1 to 188 (188 residues), 273.4 bits, see alignment E=5.1e-86 PF00117: GATase" amino acids 3 to 188 (186 residues), 193.7 bits, see alignment E=2.6e-61 PF07722: Peptidase_C26" amino acids 68 to 172 (105 residues), 32.6 bits, see alignment E=7.1e-12

Best Hits

Swiss-Prot: 65% identical to PABA_SERMA: Aminodeoxychorismate synthase component 2 (pabA) from Serratia marcescens

KEGG orthology group: K01664, para-aminobenzoate synthetase component II [EC: 2.6.1.85] (inferred from 100% identity to shn:Shewana3_0606)

MetaCyc: 66% identical to aminodeoxychorismate synthase subunit 2 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSS6 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Shewana3_0606 aminodeoxychorismate synthase, glutamine amidotransferase subunit (RefSeq) (Shewanella sp. ANA-3)
MLLMIDNYDSFTFNLVQYFQQLGQEIVVKRNDEISLAEIEALAPSHLVISPGPCSPNEAG
ISLAAIEHFADRLPILGVCLGHQAMAQVFGAKVVRAQRVMHGKVSTIGHTGERLFKGLNQ
PLTVTRYHSLLVDAIPEGFVLDAWFDDPTHGREIMAMSHKQLPLFGVQFHPESILTEQGH
ELLANFLSQSA