Protein Info for Shewana3_0604 in Shewanella sp. ANA-3

Name: sspA
Annotation: stringent starvation protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF02798: GST_N" amino acids 10 to 81 (72 residues), 62.1 bits, see alignment E=1e-20 PF13409: GST_N_2" amino acids 21 to 82 (62 residues), 55 bits, see alignment E=2.1e-18 PF13417: GST_N_3" amino acids 21 to 87 (67 residues), 54.6 bits, see alignment E=2.3e-18 PF00043: GST_C" amino acids 101 to 192 (92 residues), 37.2 bits, see alignment E=5.9e-13

Best Hits

Swiss-Prot: 70% identical to SSPA_ECO57: Stringent starvation protein A (sspA) from Escherichia coli O157:H7

KEGG orthology group: K03599, RNA polymerase-associated protein (inferred from 97% identity to sbp:Sbal223_3703)

Predicted SEED Role

"Stringent starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSS4 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Shewana3_0604 stringent starvation protein A (RefSeq) (Shewanella sp. ANA-3)
MAVAANKRSVMTLFSGADDLYSHQVRIVLAEKGVTVDVLQVDPNEMPEDLLEVNPYNSVP
TLLDRELVLYESRIIMEYLDERFPHPPLMPVYPVSRGQSRLMMHRIDTDWYSLVDRIRKG
DRAEAARKELTESLLSIAPVFGEMPYFMSEEFGLADCYLGPLLWRLPVLGIELDSRVAKD
IKAYMTRIFERESFKASLTEAEREMRMGM