Protein Info for Shewana3_0600 in Shewanella sp. ANA-3

Annotation: HflC protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01932: HflC protein" amino acids 5 to 158 (154 residues), 165.7 bits, see alignment E=6e-53 amino acids 147 to 291 (145 residues), 191.3 bits, see alignment E=9.4e-61 PF01145: Band_7" amino acids 22 to 207 (186 residues), 127.9 bits, see alignment E=2.3e-41

Best Hits

Swiss-Prot: 55% identical to HFLC_HAEIN: Protein HflC (hflC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 100% identity to shn:Shewana3_0600)

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSS0 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Shewana3_0600 HflC protein (RefSeq) (Shewanella sp. ANA-3)
MGRLSIVLIAIVLGIGLSSVMVVNEGERAIVARFGEIVKDKVDGKPVTRVFAPGIHFKVP
VIDKVKLLDARIQTLDGAADRFVTSEKKDLMVDSYVKWRIFDFEKYYLSTNGGIKSNAET
LLQRKINNDLRTEFGRRTIKEIVSGKRDELQNDALENASESAKDLGIEVVDVRVKQINLP
ANVSNSIYQRMRAERQAVAKEHRAQGKEQSEIIRATIDANVTVKIAEAERKALTIRGEGD
AQAAKIYSDAYSKDPEFFSFLRSLDAYRASFSGNSDVMVLEPDSEFFKYMKSTSPKK