Protein Info for Shewana3_0569 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF06877: RraB" amino acids 12 to 113 (102 residues), 109.1 bits, see alignment E=7.7e-36

Best Hits

Swiss-Prot: 77% identical to RRAB_SHEAM: Regulator of ribonuclease activity B (rraB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K09893, hypothetical protein (inferred from 98% identity to she:Shewmr4_0570)

Predicted SEED Role

"Ribonuclease E inhibitor RraB" in subsystem RNA processing and degradation, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSN9 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Shewana3_0569 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MSIESQLKAQLAENRDIVQALLDDGSEPDAEYTIEHHFSSSNFDRLEKAAVDAFKLGFEV
NDAEEMELEDGSVIFCFDAIAYHKLEVALLDKATEQLLQLAAKQKVDYDGWGTYFVGDDI
DDEEGDDEEDDGFPH