Protein Info for Shewana3_0535 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 88 to 124 (37 residues), see Phobius details amino acids 164 to 165 (2 residues), see Phobius details amino acids 167 to 178 (12 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 331 to 356 (26 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 285 (261 residues), 56.6 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0535)

MetaCyc: 70% identical to 1-arseno-3-phosphoglycerate exporter (Pseudomonas aeruginosa)
TRANS-RXN1YI0-17

Predicted SEED Role

"Permease of the major facilitator superfamily"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSK6 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Shewana3_0535 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MPAAKLFEQLMQLPAAVRQYLLITFNYWSFTLTDGALRMLVVLHFHDLGYTPFAIAMLFL
FYEIFGVVTNLVGGYLGARLGLNRTMNLGLGMQVLALGMLLVPAASLPLWLAGVPWVMAA
QALSGIAKDLNKMSAKSAIKLLVPKGEQGRLYHWVALLTGSKNALKGAGFFLGGALLAGL
GFNMAIAAMMAVLALVWLMSLVLLKKDLGKAKNKPKFTEIFSKSRSVNILSAARLFLFAA
RDVWFVVALPVYLASQWDWDHWAVGGFLALWVIAYGIVQTLAPKITGASRAEANTSQRIP
DGYTALVWSTLLAFVPALIALSLYLDFSPQLSLILGLMLFGGLFAINSSLHSYLIVSYAS
EEAVSLDVGFYYMANAMGRLVGTVLSGWVYQSYGLVACLWISTAFIAITALISIKLPRQV
KG