Protein Info for Shewana3_0534 in Shewanella sp. ANA-3
Annotation: glyceraldehyde-3-phosphate dehydrogenase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to G3P1_BACCE: Glyceraldehyde-3-phosphate dehydrogenase 1 (gap1) from Bacillus cereus
KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to shn:Shewana3_0534)MetaCyc: 78% identical to glyceraldehyde-3-phosphate dehydrogenase (arsenate-transferring) (Pseudomonas aeruginosa)
RXN1YI0-11 [EC: 1.2.1.107]
Predicted SEED Role
"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)
MetaCyc Pathways
- gluconeogenesis I (13/13 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
- Bifidobacterium shunt (13/15 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- heterolactic fermentation (15/18 steps found)
- pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
- superpathway of glucose and xylose degradation (14/17 steps found)
- glycolysis I (from glucose 6-phosphate) (11/13 steps found)
- Entner-Doudoroff pathway I (8/9 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- glycolysis III (from glucose) (9/11 steps found)
- arsenate detoxification V (2/2 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- homolactic fermentation (9/12 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- superpathway of N-acetylneuraminate degradation (16/22 steps found)
- glycolysis IV (7/10 steps found)
- gluconeogenesis III (8/12 steps found)
- superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- glycerol degradation to butanol (10/16 steps found)
- superpathway of hexitol degradation (bacteria) (11/18 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
Isozymes
Compare fitness of predicted isozymes for: 1.2.1.12
Use Curated BLAST to search for 1.2.1.107 or 1.2.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KSK5 at UniProt or InterPro
Protein Sequence (337 amino acids)
>Shewana3_0534 glyceraldehyde-3-phosphate dehydrogenase (RefSeq) (Shewanella sp. ANA-3) MAIKIGINGFGRMGRLALRAAWEWDDVEFVQINDPAGDAATLAHLLEFDSVHGRWRYPVT ANQDGIQIQDKTIRTTRNKTIAETDWSGCDVVIEASGVMKTKALLQAYLDQGVKRVVVTA PVKEEGVLNVVMGVNHQLYDPAIHPIVTAASCTTNCLAPVVKVIHEQIGIKHGSMTTIHD ITNTQTILDAPHKDLRRARACGLSLIPTTTGSATAITHIFPELKGKLNGHAVRVPLANAS LTDCVFELERSVTEAEVNMLLQTAAEGELKGILGYEERPLVSVDYKTDPRSSIVDALSTM VVNGTQLKLYVWYDNEWGYANRTAELARLVGQLDLPR