Protein Info for Shewana3_0528 in Shewanella sp. ANA-3

Annotation: peptidase M11, gametolysin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF05548: Peptidase_M11" amino acids 147 to 361 (215 residues), 42.6 bits, see alignment E=8.1e-15 PF17963: Big_9" amino acids 535 to 621 (87 residues), 69.8 bits, see alignment E=5.3e-23 PF17803: Cadherin_4" amino acids 537 to 601 (65 residues), 41.2 bits, see alignment E=3.9e-14 PF17892: Cadherin_5" amino acids 564 to 630 (67 residues), 56.3 bits, see alignment E=4.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0528)

Predicted SEED Role

"RTX toxins and related Ca2+-binding proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSJ9 at UniProt or InterPro

Protein Sequence (653 amino acids)

>Shewana3_0528 peptidase M11, gametolysin (RefSeq) (Shewanella sp. ANA-3)
MKYSAMMLSSLLLTNTVLAADMRPFEGTLSLEVEDFPEHAIETFRLHGKQGEVHDLALGA
TPRWLKPGQSVRVFGHANGKQLQVSDSSVSLLQTNETTSSAQTVNSAITPISGNRSVLVA
EVNFAINPIVKLTEAEIQDLLFNQSSAFYEENSYGAVSLSGDTTSPVTVDVDVSVCNTDA
VALAADQELSARGFNLNNYDHVMYLIPTHPKCTWSGKANVAGKRSWIKRVQLSTINHELG
HNLGLFHANKKDCGAVTTADSSQCTITEYGDYLSAMSGTNTPKHFNAFHKEQLGWLSGDR
IKTVTADSRVTLSPVEAEGNFPLLLKIPNGQDSSGNELFYYVEYRQPTGFDSSLATEAAA
MLNGVRLREGASNNAASSFLLDPTPNSSSYDWDDISLAPGQSFEQQGVRIDVVASDSSSV
TLDVVMQNSTAQCIRGTSSLTVQAAVSQLQQGQQGSVDLLLTNNDSSACPETTYSLTTQA
DAGLYANLANNSVTLAPQSNLHLTLSLEALQASGSNTWKVISSNQTSSQQAVSSGSVLLT
AATSNTAPLAVNDDFNDISASTVLNVLANDSDLDGDSLFISGTTQGLNGKVTVNANNTLT
YVPSKRFKGSDSFSYTVSDGKLTAVATVTISPSTTSGGTTDTSTSTGGKGKNR