Protein Info for Shewana3_0526 in Shewanella sp. ANA-3

Annotation: sigma-54 dependent trancsriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF20161: VpsR" amino acids 15 to 128 (114 residues), 32 bits, see alignment E=2.7e-11 PF00158: Sigma54_activat" amino acids 153 to 318 (166 residues), 210 bits, see alignment E=5.6e-66 PF14532: Sigma54_activ_2" amino acids 155 to 323 (169 residues), 73.2 bits, see alignment E=8.2e-24 PF07728: AAA_5" amino acids 176 to 287 (112 residues), 25.1 bits, see alignment E=4.8e-09 PF25601: AAA_lid_14" amino acids 325 to 401 (77 residues), 57.1 bits, see alignment E=4e-19 PF02954: HTH_8" amino acids 410 to 448 (39 residues), 32.4 bits, see alignment 1.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0526)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSJ7 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Shewana3_0526 sigma-54 dependent trancsriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MDEIGKPAPAETRWKRWLLVLDPEQCLPECSEELKQAAWNCVKAVSAAEALVLLQKYELR
VAIAFISDTNQTALAKEIAIIQAEYPSLHWIAVTDSALEQHCSWLSAANFVDYYHRPFDW
NRFADTLGHAWGMAQLTPSKGGKGPAKVLTTIKGEHPLLQQLRQRLHKFSQSDETVLLSG
ETGSGKGLCAKTLHSLSKRHEGPFITVNCGALPTGLIHSTLFGHEKGAFTDADKRYIGHL
EQAHGGTLFLDEIADLPLDLQVNLLHFLDDKHIMRIGGNAPIKVDCRLLFASHQDLEAAI
DEGRFREDLYHRINVLRLHVPSLRQYSDEVMLLAEQFLLEHSDNCTQFHFSDEARCAMKH
YNWPGNVRELRNRIRRAMVLTDDCIITAQLLGLDSLTANRTSQDLARCRAEHEAEVLLKA
ISDHKHNISAAARSLNISRATFYRLLKKCQIKVP