Protein Info for Shewana3_0508 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 15 to 19 (5 residues), see Phobius details transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 335 (313 residues), 135.7 bits, see alignment E=9.4e-44 amino acids 255 to 394 (140 residues), 35.9 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0508)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSH9 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Shewana3_0508 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MQAVQPNSQPPAQSSALWVLLALALGTFALGTTEFAAMTLVPYIASDLSVDVAHVSYAIS
AYALGVVVGSPIIMVLGVRIKRRTLLIALAAMMAVANGLSALAPSLNWLVFFRFLSGLPH
GAYFGVAMLLAASLVPPEMKARAVSRVIIGLTLATIVGVPFATWMGQTVGWRSGIGIVAI
IAAVTAVMLYFLAPNVAVPQNASPKKELQTLKNREVWLTLGIAAIGFGGIFCVYTYLAET
LIQVTQVEPFKIPVMMAVFGIGATLGTLVCGWAADKSALAAAFWSLVLSTLVLALYPSLT
GSYWALMPIVFFVGSGIGLATTVQARLMDVAPDGQAMTGALVQCAFNLANAIGPWVGSLV
ILSGQGIAATGYAAALLSLGGLVMWWLTHRESRRSSALCTANCID