Protein Info for Shewana3_0498 in Shewanella sp. ANA-3

Annotation: copper ABC transporter, permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 119 (15 residues), see Phobius details amino acids 124 to 149 (26 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 192 to 219 (28 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 24 to 294 (271 residues), 105.6 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to shn:Shewana3_0498)

Predicted SEED Role

"Nitrous oxide reductase maturation transmembrane protein NosY" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSG9 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Shewana3_0498 copper ABC transporter, permease protein (RefSeq) (Shewanella sp. ANA-3)
MSQISIEQGNAQYCPPRALTLIQAVAVKEFKDNLRNRWLGLMAGILLILSLCVSFMGSAV
SGTVVLLESAQIFSGLVTLAVFILPLGAILLSYDSFVGERESGTLLLLLTYPLARWHLVC
GKLLGHAYVMIAACMMGFGATALLLLTFVENQSRHALIIGFIHLISSGILLSLVFVLLGY
CVSLCVREKAKALGILLLLWFVLVLVYDLVLLTALVSLAEVFNRQLFNLLILINPTDLFR
ALNLLANPADTLSAKSSLALIAQTGMGPVLMYAMLAAWIGLLGLLACWIFARQEV