Protein Info for Shewana3_0482 in Shewanella sp. ANA-3

Annotation: peptidase S9 prolyl oligopeptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF02129: Peptidase_S15" amino acids 407 to 549 (143 residues), 30.1 bits, see alignment E=1.2e-10 PF00756: Esterase" amino acids 410 to 573 (164 residues), 26.4 bits, see alignment E=1.7e-09 PF01738: DLH" amino acids 411 to 645 (235 residues), 40 bits, see alignment E=1.1e-13 PF20434: BD-FAE" amino acids 416 to 620 (205 residues), 57.8 bits, see alignment E=3.5e-19 PF00326: Peptidase_S9" amino acids 448 to 662 (215 residues), 144 bits, see alignment E=1.5e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0482)

Predicted SEED Role

"Probable dipeptidyl anminopeptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSF4 at UniProt or InterPro

Protein Sequence (686 amino acids)

>Shewana3_0482 peptidase S9 prolyl oligopeptidase (RefSeq) (Shewanella sp. ANA-3)
MQKFPFTSQLCSAAIAAALLLTGCTTADVRNEQPQVAATQQTEAPLIPIENFFNEQSIRH
LKMSDDGKWLAFVKEYQGASNIYLMADKSDLASATPLTTSVEPIRAFEWSAKGNDLFFMK
DKGGNENTQIYKLSFEEHAGKITAKEQRLTHKDDVQYSVLEQVKDNPDLLVVQANHDDSS
RMDIYLLNINDGKLTPILKNELSFTQVKFNKQGQPVIASSSNLDNTNALYVQIDGNWRKI
IQSAKGESIDILKVNDDKKLAYISANIGDRDKQELLKVDLMTGKYETIHRDPDNEADVFA
VQFSDAGEPLAVGYYGGRLRVYPLDAEFTRHWDVINRHFNQDVEITIGEMNEKTNLWQIH
VASDRAAGADYQYNAATGDIHLLVDIPASIPADQLSPRQSIVYTARDGVKIQAYLTLPKG
KQTQLPTIILPHGGPWARDFWTLDSGYFHAIAQFYANRGYAVLQPNFRASTGFGKKFLNL
GNNNWGIGSMQHDLTDGANYLVEQGIADKQRLGIFGASYGGYAALSGATFTPDLYQAVIA
YVGPSSLVTLMNSFPDYWRPYLGQWFESVGDPQIAEQKQDMEKRSPINYVDNIKAPLMLI
QGANDPRVTQIESDNIAKKMYQKSLPVKYVLAKDEGHGFSKRANKLASIVATEQFFAEHL
GGRVDTNVNPDILKHLDSLNVDISKL