Protein Info for Shewana3_0476 in Shewanella sp. ANA-3

Annotation: redoxin domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF08534: Redoxin" amino acids 22 to 147 (126 residues), 70.6 bits, see alignment E=3.3e-23 PF00578: AhpC-TSA" amino acids 35 to 140 (106 residues), 53.4 bits, see alignment E=6.5e-18 PF00085: Thioredoxin" amino acids 44 to 99 (56 residues), 39.7 bits, see alignment E=1e-13 PF13905: Thioredoxin_8" amino acids 48 to 138 (91 residues), 40.5 bits, see alignment E=7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0476)

Predicted SEED Role

"thiol/disulfide interchange protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSE8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Shewana3_0476 redoxin domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MLLRRIIVTCLALISFSTFAADKSYQDIVLKTYPDQQQTSLKNIAGDKPIYLKFWATWCQ
PCMEQMPHFEELQKKYQDKVNFLALNININEEQPKIAEVISRFGLTMPVWLDNEGELGVA
LGLVGTPYSVLINRAGEVVYTSHESDANLDKFIDMLANGQELSAQTTDAPSLKQAAKLLK
PWEQGEHLLFFTATWCDWYLAESRPEMSKACVAAQKDLDKLAQQLPNKAWHGVVNHLWTD
DKALADFKQLYPSRVDFSIDELGVLFNHFSIRNIPTLLWVKDGEVIERITDFSQPDKIVA
RLKAAP