Protein Info for Shewana3_0459 in Shewanella sp. ANA-3

Annotation: protein of unknown function DUF853, NPT hydrolase putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 217 to 240 (24 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details PF01935: DUF87" amino acids 7 to 195 (189 residues), 32.3 bits, see alignment E=1.1e-11 PF05872: HerA_C" amino acids 8 to 494 (487 residues), 710 bits, see alignment E=1.7e-217

Best Hits

Swiss-Prot: 52% identical to YJGR_ECOLI: Uncharacterized protein YjgR (yjgR) from Escherichia coli (strain K12)

KEGG orthology group: K06915, (no description) (inferred from 100% identity to shn:Shewana3_0459)

Predicted SEED Role

"ATPase component BioM of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSD2 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Shewana3_0459 protein of unknown function DUF853, NPT hydrolase putative (RefSeq) (Shewanella sp. ANA-3)
MNTLLLGKGEQQVHLNLKYANRHGLIAGATGTGKTVSLMTLAEGFSRQGVPVFITDIKGD
ISGLGVAGTPNDKLLQRAAEIGIEDYQTEANPVVCWDLAGEQGHPLRTTVSEMGPTLLGR
ILELNDTQSSILDIVFQLADDQGLLLLDLDDLRAMLNLVADERKEVSAKYGLISAQSLAA
IQRSVLGLERDGGKDFFGEPALQLEDLMRTNLQGRGIINLLAANKLILTPSLYSSFLLWL
LSELFENLPEVGDLDKPKLVFFIDEAHLLFEGCPASLLKRIEQIMRLIRSKGVGVYFCSQ
FPDDIPNEILGQLGNRIQHALRAYTPRDQKAVKTAAETFVPNPKLVVSEVISQLAVGEAL
VSTLAEKGVPTMVERALIAPPRCRMGPASPEELSAIRAKSPIGGKYDTLINRESAYERLN
QRHAEVANGANSTKTASTPAAQEAEQGWFSELIFGNKRRQGLAETLSKQAARTVGNQLGK
QILRGLLGGILGKSTRR