Protein Info for Shewana3_0448 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 345 (324 residues), 112 bits, see alignment E=4.7e-36 PF06779: MFS_4" amino acids 35 to 365 (331 residues), 46 bits, see alignment E=7.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0448)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSC2 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Shewana3_0448 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MENIALTPSTQKPGLFVPVAGLSLFALASGYLMSLIPLSLSYFELSLDLAPWLASIFYLG
LLLGAPCIAPIVARIGHSKAFILFLNVLLCSVVVMVLLPQSSVWLAARLIAGLAVAGIFV
VVESWLLMADTQKQRAKRLGLYMTALYGGTAIGQLAVDYLGTTGNLPYLVVIGLLAAASL
PALLVKRGQPQSSEQHSIALSDLKNLSKPAVVGCLVSGLLLGPIYGLLPVYVSQDMGFAQ
QTGQFMALIIMGGMIVQPLVSYLSPRFQKSALMAAFCLIGAAALFLLTQKSLVGLWLGFV
LLGACAFALYPIAISLACDHLPSSQIVSATQIMLLSYSVGSVIGPVAASRFNHIEHGLLL
YLAASFVLTFGYLGAHLLLRSKPRLPTAKA