Protein Info for Shewana3_0427 in Shewanella sp. ANA-3

Annotation: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 668 PF00364: Biotin_lipoyl" amino acids 6 to 76 (71 residues), 60.4 bits, see alignment E=4.8e-20 amino acids 125 to 195 (71 residues), 66.1 bits, see alignment E=8.3e-22 amino acids 237 to 309 (73 residues), 69.5 bits, see alignment E=6.9e-23 TIGR01348: dihydrolipoyllysine-residue acetyltransferase" amino acids 219 to 668 (450 residues), 647.5 bits, see alignment E=1.1e-198 PF02817: E3_binding" amino acids 361 to 396 (36 residues), 65.3 bits, see alignment 1.8e-21 PF00198: 2-oxoacid_dh" amino acids 437 to 667 (231 residues), 265 bits, see alignment E=2.2e-82

Best Hits

Swiss-Prot: 56% identical to ODP2_CUPNH: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 97% identity to shn:Shewana3_0427)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KSA1 at UniProt or InterPro

Protein Sequence (668 amino acids)

>Shewana3_0427 pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (RefSeq) (Shewanella sp. ANA-3)
MAELKEVFVPDIGGDEVQVIEICASVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGTANVQAAPVAQAAAPAPAPAAPAPVQAAPAPVAAAPATGA
TQVVEVTVPDIGGDTDVSVIEVLVAAGDKIEVDAGLITLETDKATMDVPSPFAGVVKEVK
VAVGDKVSQGSLVIMLEVGGAAPAAAAPQASASAPVAQAAPAAAVAPVAAAPVVAVKEIQ
VPDIGDASNVDVIEVLVSVGDMITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGDKV
SQGSVIATIETVTAGAAPAPQAAAPAPVAQEAAPAPVAAAPSRPPVPHHPSAGAPVATGV
VHASPAVRRLAREFGVDLTQVTGSGRKGRIMKEDVQAYVKYELSRPKATAATSVAAGNGG
GLQVIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFRK
QQNDAAAKKKADYKITPLVFMMKAVAKTLQQFPVFNSSLSSDGESLIQKKYYHIGVAVDT
PNGLVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAFT
PIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGIL
SDIRTLIL