Protein Info for Shewana3_0424 in Shewanella sp. ANA-3

Annotation: regulatory protein AmpE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details PF17113: AmpE" amino acids 1 to 281 (281 residues), 124.6 bits, see alignment E=2.6e-40

Best Hits

KEGG orthology group: K03807, AmpE protein (inferred from 100% identity to shn:Shewana3_0424)

Predicted SEED Role

"AmpE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS98 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Shewana3_0424 regulatory protein AmpE (RefSeq) (Shewanella sp. ANA-3)
MALFSLLVAILVERLKFLPASWQCDRVLQSYQSTFFGDKASLTSTNMLLALVLPALVVHV
LGWVASGMFWGLLTLALWVVVAIICFNHQKQRDSFKKYMQAACRSDVQACYHYAAELDCS
ECLDAVSEKDLGAKVGQSVAWINYRYYGAVALCFIFLGPVGAVLYCTARFYAEENVRKSL
NLPLIEDIMFVMDWIPSRIFSFGYALSGQFSEGLSAWRDHALNIHASARRVVTETALAAQ
PLPEESSAPVCVQSTLALLVLSKRNFTLMVAVLSLLTIFGLVS