Protein Info for Shewana3_0419 in Shewanella sp. ANA-3

Annotation: type IV-A pilus assembly ATPase PilB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02538: type IV-A pilus assembly ATPase PilB" amino acids 10 to 568 (559 residues), 877 bits, see alignment E=3e-268 PF05157: MshEN" amino acids 62 to 146 (85 residues), 63 bits, see alignment E=2.1e-21 PF00437: T2SSE" amino acids 179 to 565 (387 residues), 529 bits, see alignment E=4.9e-163

Best Hits

Swiss-Prot: 66% identical to TAPB_AERHY: Type IV pilus assembly protein TapB (tapB) from Aeromonas hydrophila

KEGG orthology group: K02652, type IV pilus assembly protein PilB (inferred from 100% identity to shn:Shewana3_0419)

Predicted SEED Role

"Type IV fimbrial assembly, ATPase PilB" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS93 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Shewana3_0419 type IV-A pilus assembly ATPase PilB (RefSeq) (Shewanella sp. ANA-3)
MPSAGLHLGLSTLFIRKGLLNEEQMASAITKSRQNKQTLVTTLVQTKLVSARSIAELCYE
EYGTPLLDLAEFDVSAIPEEFLNKKLIEKHRCLPLFKRGNRLYIATSDPTNIAALEEFQF
SAGLHAEAILVEEDKLAKALEKVLEEDITGLDLSGMDEAALAGIEVTDTDKRQEENAGEA
SDDAPIVIYINKILTDAIRKGASDLHFEPYEKRYRIRFRIDGILHEVSEPPISLAGRLSA
RLKVMSKLDIAERRVPQDGRIKMKLSRTKSIDFRVSTLPTLWGEKIVMRILDSSSAQLGI
EKLGYEPDQEKLYLEMLAKPQGMILVTGPTGSGKTVSLYTGLNILNTAERNISTAEDPVE
INLEGVNQVHINLKAGLTFASALRSFLRQDPDVVMVGEIRDLETAEIAIKAAQTGHLVLS
TLHTNSAAETLTRLINMGVPGYNIASSVNLIIAQRLARRLCTECKQAEQIPEHELQRLGF
TDEQIAQGFTTFKPVGCEHCSGGYKGRVGIYEVMKMSDEIARTIMEGGNSLQIADQAKAQ
GMRDLRQSGLLKVLQGVTSIAEINRVTSF