Protein Info for Shewana3_0404 in Shewanella sp. ANA-3

Name: frdB
Annotation: fumarate reductase iron-sulfur subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF13085: Fer2_3" amino acids 8 to 113 (106 residues), 104.8 bits, see alignment E=3.7e-34 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 11 to 235 (225 residues), 175.6 bits, see alignment E=5.1e-56 PF13237: Fer4_10" amino acids 149 to 222 (74 residues), 26 bits, see alignment E=1.1e-09 PF13183: Fer4_8" amino acids 150 to 224 (75 residues), 41.4 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 57% identical to FRDB_WOLSU: Fumarate reductase iron-sulfur subunit (frdB) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K00245, fumarate reductase iron-sulfur protein [EC: 1.3.99.1] (inferred from 100% identity to son:SO_0399)

MetaCyc: 52% identical to fumarate reductase iron-sulfur subunit (Helicobacter pylori 26695)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS78 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Shewana3_0404 fumarate reductase iron-sulfur subunit (RefSeq) (Shewanella sp. ANA-3)
MSQGRQLTFNIFRYDPQEPNDKPKMVRYQLTETPGMTVFIALNKLREEQDTSLQFDFVCR
AGICGSCAMVINGFPTLACRTLTAKYPKGEITLMPLPGFELIGDLSVNTGKFMRELAERL
KLWLHPKANDISIHHLEEPMAPEEAARLYELERCVECGVCVSACATKQMRETFVGAVGMM
KIARFELDSRDARTAEDFYHVIGNQDGVFGCMTLLGCQDNCPKDLPHMQQIAYLRRKMAM
TLV