Protein Info for Shewana3_0398 in Shewanella sp. ANA-3

Name: fis
Annotation: DNA-binding protein Fis (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF02954: HTH_8" amino acids 58 to 98 (41 residues), 57.7 bits, see alignment E=3.8e-20

Best Hits

Swiss-Prot: 100% identical to FIS_SHEB8: DNA-binding protein Fis (fis) from Shewanella baltica (strain OS185)

KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 94% identity to spl:Spea_0389)

Predicted SEED Role

"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS72 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Shewana3_0398 DNA-binding protein Fis (RefSeq) (Shewanella sp. ANA-3)
MFDQTTNTEVHQLTVGKIETANGTIKPQLLRDAVKRAVTNFFAQLDGQEAQEVYEMVLSE
VEAPLLDIIMQHTRGNQTRAANMLGINRGTLRKKLKKYGMN