Protein Info for Shewana3_0397 in Shewanella sp. ANA-3

Annotation: hemerythrin HHE cation binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF04405: ScdA_N" amino acids 24 to 77 (54 residues), 73.1 bits, see alignment E=1.2e-24 TIGR03652: iron-sulfur cluster repair di-iron protein" amino acids 27 to 244 (218 residues), 261.4 bits, see alignment E=3.4e-82 PF01814: Hemerythrin" amino acids 100 to 244 (145 residues), 77.2 bits, see alignment E=1.6e-25

Best Hits

Swiss-Prot: 37% identical to YTFE_YERPN: Iron-sulfur cluster repair protein YtfE (ytfE) from Yersinia pestis bv. Antiqua (strain Nepal516)

KEGG orthology group: K07322, regulator of cell morphogenesis and NO signaling (inferred from 99% identity to shm:Shewmr7_3627)

Predicted SEED Role

"Nitric oxide-dependent regulator DnrN or NorA" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS71 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Shewana3_0397 hemerythrin HHE cation binding domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MLSAHLSSENPVEAQSASITPWLERKVGELVAEDFRRAHVFSQFGIDFCCGGGRALVNAC
ERAEANPEQVVAALEAVSHSGAKEDELNQLPLDQLIDYIERTHHQYVRAKAPLLLEYSEK
MVRAHGEHYAEIIPFAGWVRALIEDLMPHLMKEENILFPAIRAMSRGEQVQGCFGHIGNP
INAMQYEHEEAGQILQKLHELTNDFTPPEYACTTWRVCYATLVEFEADLHRHIHLENNIL
FPKALQLA