Protein Info for Shewana3_0353 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details PF01595: CNNM" amino acids 9 to 199 (191 residues), 155.9 bits, see alignment E=9.2e-50 PF03471: CorC_HlyC" amino acids 350 to 426 (77 residues), 73.2 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 59% identical to YTFL_ECOL6: UPF0053 inner membrane protein YtfL (ytfL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0353)

Predicted SEED Role

"Putative hemolysin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KS27 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Shewana3_0353 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MSLLDNVMIILCLIGASCFFSMSEIALAASRKIRLRQLADEGDSRAEKVLQLQAQPGSFF
TVVQIGLNAVAIMGGIVGESAFRPYFYQFLSAWLSDPWLSQLSFFLSFFVVTSAFILVAD
LMPKRIAMAMPESVALVVVGPMSFCIAILRPLVWFFNGMASGIFKLLQIPTVRNDEITPD
DIYAVMNAGAEAGVLDKGEQQMIENVFEMQTVSVTSAMTARESLVYFLLQDSEEDIKRKI
AEDPHTKFLVCDGQLDMVKGFVDAKELLIRVINGEKITLKDNSLVHTSLIIPDTLSLSEA
MEYFKNSRADFAVVMNEYALVVGIVTTNDLQRAVMGAWSLHESEEQIIARDGNSWLVDGV
TPITDVMRAFDIEEFPHNQNYETIAGFMMYMLRKIPKRTDFVNYAGYKFEVVDIDAYKVD
QLLVTRIDGNDKLMSPDT