Protein Info for Shewana3_0311 in Shewanella sp. ANA-3

Name: rbn
Annotation: ribonuclease BN (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 20 to 276 (257 residues), 281.9 bits, see alignment E=3.2e-88 PF03631: Virul_fac_BrkB" amino acids 30 to 277 (248 residues), 220.3 bits, see alignment E=1.8e-69

Best Hits

Swiss-Prot: 100% identical to Y311_SHESA: UPF0761 membrane protein Shewana3_0311 (Shewana3_0311) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to shn:Shewana3_0311)

Predicted SEED Role

"Inner membrane protein YihY, formerly thought to be RNase BN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRY5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Shewana3_0311 ribonuclease BN (RefSeq) (Shewanella sp. ANA-3)
MTKKIELAQIQVLFLGIWRFLLHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLS
AFPVFKGIRGQIEAFVYENFLPAAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISA
IDKSLNNIWRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEGDALSGVM
PLFIERLPMLFSVAAFLLLYMVVPNQKVKFWHALLGAVVAALLFELGKKGFALYVTKFPS
YEAIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEYLDYESSSNINETNLDGEPLAAQ
NTPAVEPETISAQSSQEVDTMGELAANAPQSTTLDKP