Protein Info for Shewana3_0307 in Shewanella sp. ANA-3

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 46 to 74 (29 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 157 to 186 (30 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details PF12801: Fer4_5" amino acids 154 to 198 (45 residues), 45.3 bits, see alignment 1e-15 amino acids 259 to 296 (38 residues), 25.6 bits, see alignment 1.4e-09 PF13237: Fer4_10" amino acids 303 to 353 (51 residues), 27.2 bits, see alignment 4.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0307)

Predicted SEED Role

"Hypothetical iron-sulfur cluster binding protein YccM" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRY1 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Shewana3_0307 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MEYVYSICSINMTFIESLTLMLALMYIASLSYWSGKKWGAVATLLLSVGAVAISLYWPLA
LALAIALPLCLIANKFAPEELKGEIKINTLREGCQHLLALSLFIVAIQYCINAIQLKQGI
VPWLMRPDVADAFLPIAGGIELKAILALNLWDQTHPAAAVMLFAVLLTGLLCKRAFCGWA
CPLGLAGEYLYALRKRFIKAELAPPAWLDWPLRMLKYLLLLALFYIVIGMPSESIPYYLQ
GNYHKIADLKMALFFVTPGLITLACFALILALAAWRRQGFCRYLCPYGAMLGILSFASPL
KIRRDTQHCLIEAKGMKCDKCTRACPANIIVHTKTTVRSDECQACMRCVAACPKSAALGF
GLKSGHRVSHKGLLVLLLLALFALPLGAYLAGFWHSQTPDSIRMELIQVIDRVGH