Protein Info for Shewana3_0297 in Shewanella sp. ANA-3

Annotation: sodium:dicarboxylate symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 87 to 114 (28 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 270 to 280 (11 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 334 to 384 (51 residues), see Phobius details PF00375: SDF" amino acids 28 to 406 (379 residues), 266.5 bits, see alignment E=2.1e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0297)

Predicted SEED Role

"proton/glutamate symporter family protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRX1 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Shewana3_0297 sodium:dicarboxylate symporter (RefSeq) (Shewanella sp. ANA-3)
MTHRNNDKNNRRLAMWQKLKPYQDSIVLLSALLLGGIIGIYWPSLALKLKPLGQIFLNLL
FMIIVPLVAISVTSSIARMTDLKKLGAILASIMGVSILMAIIPAVGITLLALVFDPAQGV
TLDLNQTVSDTSGKMDFVALLTTNDFSGLLSKSNILALIIMSVIAGIAIGQSGEDGRKVS
ALLDSFNTVIMKIVSIIMLAAPVGLGAYFASTMASQDPQLVVTFARAVGLFLVACFIYLT
VGSTFYAWLGGGMHGIRQFWRHALEPAVTALGTTSSLATLPVTLRAALKMGIKPEIADIS
LPLLVNLNKGGASIITALKIVFIYSLLGLDFTVDVFMVTILISVLSAFIIGGVPGGAFLG
EIFIVTALGLPMETIPILVVIGAITDAPSTVINVVHDLNASQIVERLNCKRIES