Protein Info for Shewana3_0277 in Shewanella sp. ANA-3
Annotation: molybdopterin synthase subunit MoaE (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to MOAE_VIBCH: Molybdopterin synthase catalytic subunit (moaE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 100% identity to shn:Shewana3_0277)MetaCyc: 60% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]
Predicted SEED Role
"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis
MetaCyc Pathways
- molybdopterin biosynthesis (5/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.-.-.-
Use Curated BLAST to search for 2.-.-.- or 2.8.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KRV1 at UniProt or InterPro
Protein Sequence (155 amino acids)
>Shewana3_0277 molybdopterin synthase subunit MoaE (RefSeq) (Shewanella sp. ANA-3) MRLLPNVRVQTVDFNVADEYHQLAQDNSDGAVVTFVGKVRDFNDGSVVTDLTLEHYPCMT ERVLEQIVAEARERWPLNKVTVIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLK TKAPFWKLEAGDKGKNWVEAKDADEQAAQLWQHKD