Protein Info for Shewana3_0275 in Shewanella sp. ANA-3

Name: moaC
Annotation: molybdenum cofactor biosynthesis protein C (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 5 to 153 (149 residues), 233.7 bits, E=3.3e-74
• PF01967: MoaC
  • amino acids 16 to 151 (136 residues), 199 bits, E=1.5e-63

Best Hits

Swiss-Prot: 100% identical to MOAC_SHEON: Cyclic pyranopterin monophosphate synthase (moaC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to shm:Shewmr7_3747)

MetaCyc: 80% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (5/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

See A0KRU9 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Shewana3_0275 molybdenum cofactor biosynthesis protein C (RefSeq) (Shewanella sp. ANA-3)
MSNVFTHINADGNAHMVDVTEKAVTEREARAEAFIEMASTTLEMIMSGSHHKGDVFATAR
IAGIQAAKKTSDLIPLCHPLMLTKVEVELEAQPEHNRVRITSLCKLSGKTGVEMEALTAA
SVAALTIYDMCKAVQKDMVISQVRLLEKRGGKSGHFKAE