Protein Info for Shewana3_0251 in Shewanella sp. ANA-3

Annotation: Fis family GAF modulated sigma54 specific transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 PF01590: GAF" amino acids 82 to 198 (117 residues), 53 bits, see alignment E=1.6e-17 PF00158: Sigma54_activat" amino acids 306 to 469 (164 residues), 215.9 bits, see alignment E=9.1e-68 PF14532: Sigma54_activ_2" amino acids 317 to 474 (158 residues), 62.5 bits, see alignment E=1.6e-20 PF07728: AAA_5" amino acids 325 to 443 (119 residues), 27 bits, see alignment E=1.2e-09 PF13556: HTH_30" amino acids 591 to 624 (34 residues), 28.3 bits, see alignment (E = 3.7e-10) PF02954: HTH_8" amino acids 594 to 624 (31 residues), 38.9 bits, see alignment (E = 1.7e-13)

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0251)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRS5 at UniProt or InterPro

Protein Sequence (628 amino acids)

>Shewana3_0251 Fis family GAF modulated sigma54 specific transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MEQRSGSLAMTVKLHFPTTQAWLTDSWQRSLGAGLSEFRAGEDLRLTRSELKYKHEQYQQ
LIELVQSHALPLFNQLMAHSNSRLLLSDADGYVLKHWGVSRYSSKLADVALDIGVNWLEK
YKGTNAIGTALTAKQAVSVVGEQHFIRQNRFMSCTACPIFSPQGEMLGVLDITSEQQRHS
QQTLMLVSSLAQQVETALLCHLPDSHYRIDFAAQPSLLNSGWQGIVIASSDGRIVGCNPM
AKQLLSQAKLGDSLDQHLGDNWARAGGFHRDSALHVQTQALALTQTKSTRTLQDKPLNQL
GVRFRDPLLERAWQQANKVITKQIPLLVLGETGVGKEQFVKKLHAQSTRRAQPIVAVNCA
ALPAELVESELFGYQAGAFTGANRTGFIGKIRQAHGGFLFLDEIGEMPLAAQSRLLRVLQ
EREVVPVGSNQSFKVDIQIIAATHMDLESLVAQGLFRQDLFYRLNGLQVRLPALRERQDI
ERIIHKLHRRHRSSAQTLCTELLAQLMRYDWPGNLRELDNLMQVACLMAEGEAVLEINHL
PDYLAQKLMNLACEPQTLTEVADAEATAHPHELVESSSVTIDSLHGTINLNVLQAYRACD
GNVSQCAKRLGISRNALYRKLKQLGIKD