Protein Info for Shewana3_0245 in Shewanella sp. ANA-3

Annotation: cytochrome B561 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 11 to 185 (175 residues), 86.6 bits, see alignment E=9.3e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0245)

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRR9 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Shewana3_0245 cytochrome B561 (RefSeq) (Shewanella sp. ANA-3)
MSSNMQQNIKVWDPLIRIFHWSLVGFFTLAYLTEGEDEWMNIHSYAGYSILTLLVFRLLW
GVIGTHHARFINFVTRPSIAWAYLKELFTGKAKDYIGHNPAGALMIVALILSIGFTGFSG
MALYATDGQGPLATSFFATWPEGALKEVHEFFANFSLLLIVTHVGGVIVSSLLHKENLVK
AMLTGKKQRQLIQQDEHQ