Protein Info for Shewana3_0236 in Shewanella sp. ANA-3

Annotation: cytochrome C biogenesis protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 108 to 129 (22 residues), see Phobius details TIGR03147: cytochrome c nitrite reductase, accessory protein NrfF" amino acids 12 to 130 (119 residues), 171.5 bits, see alignment E=3e-55 PF03918: CcmH" amino acids 12 to 154 (143 residues), 173.2 bits, see alignment E=1e-55

Best Hits

Swiss-Prot: 48% identical to CCMH_PSEFL: Cytochrome c-type biogenesis protein CcmH (ccmH) from Pseudomonas fluorescens

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to shn:Shewana3_0236)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRR1 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Shewana3_0236 cytochrome C biogenesis protein (RefSeq) (Shewanella sp. ANA-3)
MRTLTKIIGGLVLLLSMATAAMATPVDTYEFKSPENQKRGLSLAHELRCPQCQNQNLIDS
NSPVARDLRLEVYKMVDEGKGDDEIIEFMTSRYGEFVLYKPKMETKTYILWLGPVGLLLL
GLIIGFIFIRKQRIGGCTEAEISAEDQKALDALLKRDTK