Protein Info for Shewana3_0234 in Shewanella sp. ANA-3

Annotation: cytochrome c-type biogenesis protein CcmF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 249 to 265 (17 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details amino acids 449 to 470 (22 residues), see Phobius details amino acids 490 to 512 (23 residues), see Phobius details amino acids 614 to 633 (20 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 55 to 639 (585 residues), 782.6 bits, see alignment E=1.5e-239 PF01578: Cytochrom_C_asm" amino acids 89 to 295 (207 residues), 181.4 bits, see alignment E=2e-57 PF16327: CcmF_C" amino acids 315 to 636 (322 residues), 405.6 bits, see alignment E=1.7e-125

Best Hits

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 100% identity to shn:Shewana3_0234)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRQ9 at UniProt or InterPro

Protein Sequence (659 amino acids)

>Shewana3_0234 cytochrome c-type biogenesis protein CcmF (RefSeq) (Shewanella sp. ANA-3)
MIPELGHFSLIIGVAFAFLLVSVPLIGVARKDQYLVRYAWPLTYGMFFFIALSVVSLGYS
FAVDDFSVAYVAHHSNSQLPIFFKIAAVWGGHEGSLLFWVFALSTWAASVALFSKGLEEV
FTARVLAVLALIVIGFSLFMLLTSSPFERLFPMPAEGRDLNPMLQDVGLIFHPPMLYLGY
VGFSVSFAFAIAALMSGHLDSAWARWSRPWTLAAWIFLTGGIALGSWWAYYELGWGGWWF
WDPVENASFMPWLVGTALVHSLIVTEKRGAFRNWTVLLSIFAFSLSLLGTFIVRSGVLTS
VHSFAADPSRGMFILLLLGLAIGGSLTLFAFRASEMSSPARFELKSKETMLLVCNVLLTV
AAGTVLLGTLYPLLIDALGMGKISVGPPYFNAVFVPIVLVLFGFMGVGPIIRWKKSKAGE
LKRQLLVPALVSAAIGIVTPFIVDGAFNAWVACGIAAASWIVLATARAAYNIVKPKEGEV
SVARMGRSELGMILAHLGIAVSVIGATMVSNYSVEKSVRMGPGVSQELAGYTFKYLETKN
VVGPNYTAQQGQIEIYKGDKLLTLLKPDRRQYNVRTMDMTEAGIDWGLFRDLYVTMGDPI
SSTEFAVRLNYKPFVRWLWFGAIFMMVGGFFAASDKRYRSKVAATVKPQAEKAKLATAQ