Protein Info for Shewana3_0230 in Shewanella sp. ANA-3

Annotation: heme exporter protein CcmB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 99 to 127 (29 residues), see Phobius details amino acids 134 to 160 (27 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details PF03379: CcmB" amino acids 11 to 225 (215 residues), 327.2 bits, see alignment E=2.1e-102 TIGR01190: heme exporter protein CcmB" amino acids 14 to 224 (211 residues), 304 bits, see alignment E=2.7e-95

Best Hits

Swiss-Prot: 65% identical to CCMB_HAEIN: Heme exporter protein B (ccmB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02194, heme exporter protein B (inferred from 100% identity to shn:Shewana3_0230)

MetaCyc: 62% identical to cytochrome c maturation protein B (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRQ5 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Shewana3_0230 heme exporter protein CcmB (RefSeq) (Shewanella sp. ANA-3)
MKRGISFTQAFLTLLQRDLKIAIRHRGDIFNPLLFFIMVVTLFPLGIGPEPQMLARIAPG
IIWVAALLASMLSLERLFKADFSDGSLEQMLLSPQPLSVLVLAKVLAHWLLTGVPLIIIA
PLLAVLLNLDANSYGALIATLALGTPVLSLLGAIGVALTVGLRKGGVLLSLLILPLYIPV
LIFATSAIDAAGMNLPYDGQLAIIGAMLIGSLTLAPFAIGASLRVSTN