Protein Info for Shewana3_0133 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1077 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 427 to 448 (22 residues), see Phobius details PF08376: NIT" amino acids 59 to 264 (206 residues), 42.1 bits, see alignment E=5.6e-14 TIGR00229: PAS domain S-box protein" amino acids 512 to 630 (119 residues), 72.5 bits, see alignment E=3.5e-24 PF13188: PAS_8" amino acids 512 to 559 (48 residues), 28.2 bits, see alignment (E = 5.3e-10) PF00989: PAS" amino acids 513 to 620 (108 residues), 47.7 bits, see alignment E=5.8e-16 PF08448: PAS_4" amino acids 518 to 624 (107 residues), 31.5 bits, see alignment E=7.4e-11 PF13426: PAS_9" amino acids 520 to 621 (102 residues), 51.7 bits, see alignment E=3.7e-17 PF08447: PAS_3" amino acids 534 to 615 (82 residues), 36.2 bits, see alignment 2.4e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 633 to 794 (162 residues), 140.9 bits, see alignment E=3.2e-45 PF00990: GGDEF" amino acids 634 to 791 (158 residues), 168.7 bits, see alignment E=3.7e-53 PF00563: EAL" amino acids 811 to 1048 (238 residues), 257.6 bits, see alignment E=4e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0133)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRF8 at UniProt or InterPro

Protein Sequence (1077 amino acids)

>Shewana3_0133 diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq) (Shewanella sp. ANA-3)
MPSTLQHLSLKQKLILFSLLPLLMMSIFVLSRMYVLVKEYRSANQNHLAIQATAQTTELL
YQLHNEYGLSVQLSAPGSPQEETRLLQQQQITSDALDTLLNGSALSALMSALGRNQLAAA
QLQEQLNTLTLLSHRLASGHQEALDQHPKAFIDLYNQFNTELVKLIQQLQLQTNDIAQSR
AYTDLLNLLMVQQLAVKERSAINRMLLSQTLNINDYRAISTIMYEYGQAIEHASNASISD
RQSLIRKVQTSPENLRILKISQQIEQQIRVSTLVQNINAHLGYGGLIDSFQDYLIKGDAA
SLEKFTKAQAIIQLNLDELNHEIRNIPELKAAVRTIEDSVDQYQFCMSKLQQLKQQQLSL
EEITALAQVNDSGLSEAIDKLLMPPHPVSSKHWWSLTSDRINKLHAISDEITEKMAHQSE
VEQTKSLSLLGLYLFSAIFTAAITLWLGRKIIRSFMVKITKIANDMQQMAADPQLNINID
ASGTDELARMAQAMNRMISERQKANHALSRAAAVFNYSAEGIMVTDADNHIELINPAFSQ
ITGYSLEEVKGRSPSILSSNRHPHHYYTAMWEALHKEGKWEGEIWNKRKDGQVYPEYLAI
TVVRNEQGEIIQHIGLFMDISKRKQYEQDLWYQANFDTLTGLPNRKLFNERLQHEIQLAQ
HDSRKLAILLIDLDQFKYINDVQGHATGDLLLQDVAKRLENIAGKNDFVARIGGDEFVLI
LPRVTNEFAIEHMASRIIETLATPFNLNEREIQISASFGIGVYPEDGLDVSSLTRNTEMA
MYQAKDAGRNNFKYFTSGMNQAMFARMELEQRLRRAVAQDEFTLFYQPIVDMKTGQICSV
EALIRWQDPDLGLIPPDQFIAIAEETGLIEPMGEWVLNQAMHDLRQWQHMGLNLNVAINV
SSRQCINTRGIGFDQVLQECFNRHHINPRNVHIEITESMLMGDASHCLSTLESIRHLGSQ
IYIDDFGTGYSSLSYLKKFPISVIKIDRSFVEHALENCSNANLVKAIVMMGQSLEMELVA
EGIETEAQWQFLRDLGCHYAQGYLLSKPLPFDEITPLLGQTLPKMLHLEQREKCVNS