Protein Info for Shewana3_0130 in Shewanella sp. ANA-3

Annotation: molybdopterin biosynthesis protein MoeB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02355: molybdopterin synthase sulfurylase MoeB
  • amino acids 12 to 251 (240 residues), 447.5 bits, E=5.3e-139
• PF00899: ThiF
  • amino acids 16 to 249 (234 residues), 233.4 bits, E=9e-74

Best Hits

Swiss-Prot: 62% identical to MOEB_ECOLI: Molybdopterin-synthase adenylyltransferase (moeB) from Escherichia coli (strain K12)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 100% identity to shn:Shewana3_0130)

MetaCyc: 62% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (5/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Sequence Analysis Tools

See A0KRF5 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Shewana3_0130 molybdopterin biosynthesis protein MoeB (RefSeq) (Shewanella sp. ANA-3)
MNEQLEILSDGELTRYSRQISIKAMDIDGQERLKLARVLMIGAGGLGCAAGQYLTVAGIG
ELTLVDFDTVELSNLQRQVLHQDATIGQPKVESAKQSLNRLNPHVKINTINAVLDDHEID
ALVASHSIVVDCTDNVSVREQLNQSCFKHKIPLVSAAAIRMEGMVTIFDYQAQTPCYHCF
SSLFGEQQLSCVESGILAPVVGMVGCLQAVEAIKVIAGMGKTLAGRILMIDAMTMEFREM
KLPKQPRCKICGE