Protein Info for Shewana3_0125 in Shewanella sp. ANA-3
Annotation: chorismate lyase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to UBIC_SHESA: Probable chorismate pyruvate-lyase (ubiC) from Shewanella sp. (strain ANA-3)
KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 97% identity to she:Shewmr4_0126)Predicted SEED Role
"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)
MetaCyc Pathways
- superpathway of chorismate metabolism (51/59 steps found)
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
- 4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
- ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
- polybrominated phenols biosynthesis (1/4 steps found)
- spongiadioxin C biosynthesis (1/7 steps found)
- polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
- p-HBAD biosynthesis (1/9 steps found)
- tetrahydromethanopterin biosynthesis (3/14 steps found)
- superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
- phenolphthiocerol biosynthesis (1/23 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.3.40
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KRF0 at UniProt or InterPro
Protein Sequence (187 amino acids)
>Shewana3_0125 chorismate lyase (RefSeq) (Shewanella sp. ANA-3) MNVTSLSFPYGESIQWFCADNAKNLPSSPLKEWLLAPGSLTQKLKGCCDKFEVKILGEGQ CAPLEGEYPKQNAVWVREVLLCLDSVPWVFARTLIPQSLLSTRQADFLGLGTRPLGELLF SQDSFVPGRIEIARFTTDSRLAQLAQSLAQNVEHELWGRRRYFHHDEEEMFVSEMFLPAA VQAMARL