Protein Info for Shewana3_0083 in Shewanella sp. ANA-3

Annotation: HPP family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details PF04982: HPP" amino acids 54 to 178 (125 residues), 150.2 bits, see alignment E=1.5e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0083)

Predicted SEED Role

"Membrane protein, HPP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRA9 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Shewana3_0083 HPP family protein (RefSeq) (Shewanella sp. ANA-3)
MRFYFTRMRSKDICPPRQPLKKIVWSWVGAFCGIYLVASLASYMSDNLLGTMFVIGSFGA
SAVLVYGAPLAEFSQPRNLIGGSVLSALIGVAVYQVFADYMVLASALAVSLAIALMYLTR
TLHPPGGATALIAVIGGENVHQLGFLYALMPVFLGSLLLLLVALVVNNLSTDPKRHYPVY
WI