Protein Info for Shewana3_0079 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 29 to 55 (27 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 346 to 369 (24 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to shm:Shewmr7_0075)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRA5 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Shewana3_0079 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MSAAKPIAESTTRIGTSHSLNPFNGMLRLWFFDVGSVSFIGTGIFGLALSVLAGWAGQKA
SFDIFVTMGLVSTSAAVAWQLIRLMASECSILIPRYRQNIFIQCEVMLIGAFSLAVLQCV
LFDLTDTLSLLVFAQGISLGFILLCLRQTQWFYSSFLLFILVPFSNELAEQVPLWLSIIV
LFVLAALIWRRCLVLPWRVEARSVYLNGLEMGWFWLPSLQSIRILTRLERYLHPVNFFIG
PMLTVLLLLLPVLTIGLGIVSHELHWNFPVLLLLAQFSVISCSLVHWSRVQRSRATEMLL
LMPSFDGRAGLVKAFGRGQQRLLLLLSLSVLICSLFVTWLDGDLSLPLLAHIVMSTYWAC
ALVLGLGCLCRRVLQVSLTMLVVLGHSLWVSISLAALQHDGSLLYWSLGNLVLLILGQIA
LIWGSKKLWQGDITGL