Protein Info for Shewana3_0076 in Shewanella sp. ANA-3

Annotation: TAP domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 113 to 250 (138 residues), 48.4 bits, see alignment E=1.1e-16 PF08386: Abhydrolase_4" amino acids 398 to 497 (100 residues), 76.7 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0076)

Predicted SEED Role

"FIG032621: Hydrolase, alpha/beta hydrolase fold family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRA2 at UniProt or InterPro

Protein Sequence (539 amino acids)

>Shewana3_0076 TAP domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MIDSMIHRKSHNASADVAMKRVDTRQHSGKLSKSIISLSALMLAMGSATAWASDNSVKPT
ESANTCYVEGVSDRLNCGFVTVPENPNKPDGKQIQVHYVVLPAVKNVNHEEALLAIAGGP
GQSAIDNAAGFDSMLNKVRQQRDILLIDQRGTGRSNVLNCDAGPQSPLSFDDDNVDTLAE
AQKCRDQFPDTDVTQYGSLNAVQDFEAVRAQLGYKKLHLYGISYGTRMAQLYMRLYPEHL
ATVTIDGIVPMQQSVLEIGSAIERGFDLLFKDCQDTAACHAEFPELKAEFDQVVAKLSQG
PVMEQVHDPVTGEKTLLTMTRSKFYGAIRMALYQTNVRALVPHAIHQAAKGNYQPLLGLF
ALTTDNAGMAMGMHASVVCGEDIHRITPAMREQAKTSYVGKTMLESLEASCSVWKVPPVD
ANFSEPIKSDIPTLLLSGEIDPATPPSWGELAMEKLTNAKHFVAPYATHGVAYQSCANNL
VAELVRTGSVNDLDGECLKKDVRRSFYLNASSVEPLATEDATHSSKDKPKDKPSTGAKE