Protein Info for Shewana3_0075 in Shewanella sp. ANA-3

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00005: ABC_tran" amino acids 17 to 160 (144 residues), 95.9 bits, see alignment E=3.2e-31

Best Hits

Swiss-Prot: 41% identical to NATA_BACSU: ABC transporter ATP-binding protein NatA (natA) from Bacillus subtilis (strain 168)

KEGG orthology group: K09697, sodium transport system ATP-binding protein (inferred from 99% identity to she:Shewmr4_0073)

MetaCyc: 41% identical to Na+ ABC efflux transporter ATP-binding protein (Bacillus subtilis subtilis 168)
RXN-17739 [EC: 7.2.2.3, 7.2.2.4]

Predicted SEED Role

"ABC-type Na+ transport system, ATPase component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.3 or 7.2.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KRA1 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Shewana3_0075 ABC transporter related (RefSeq) (Shewanella sp. ANA-3)
MIKVSHLSKRIGEVQALNDLSFVAENGQITGLLGPNGAGKTTCLRTIFGLLKPDTGTAEI
EGIDVAIDPIGAKQQLGLFPDPFGLYERLTPREYIRYFAELSGLSASDAKAATDNVIAKL
RLEDISDRRCKGFSQGQRMKTALAQAIVHSPSNIILDEPTRGLDVMSTRLLRDILIDLKN
QGHCVLFSSHVMQEVAALCDQVIVMAQGRVVAIGSPDQLCAQTGKASLEDAFIQLIGTDE
GIAA