Protein Info for Shewana3_0072 in Shewanella sp. ANA-3

Annotation: transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 95 to 186 (92 residues), 41.8 bits, see alignment E=1.5e-14 PF00165: HTH_AraC" amino acids 236 to 277 (42 residues), 30.1 bits, see alignment 6.1e-11 PF12833: HTH_18" amino acids 249 to 328 (80 residues), 78 bits, see alignment E=8.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0072)

Predicted SEED Role

"Transcriptional regulator, AraC family, homolog 5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR98 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Shewana3_0072 transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MKRITILATDNTVASGIIGFLDVFSFCNTYWRRVNPQAEQDLFECQVVSSHGGDILTNQG
IKVPAVGLNTPNDILHSDAVILASAMVTNKSEFQNYLHDFESLFEPLRLFADSGKPLAAY
CSGTLILAASGLLDGREATTVWWLNEMFQRHFAKVNLRMDKLVVSDGHLHTAGATTSNMS
LALHLVHILVGEQLASQMAKILLIDPNRQSQQPFMTMDLMTSSHKDEVIWNVQQWMQHHL
TEPLLLDDIADKFALGKRTLIRRFKKALNETPASYVQRLRVDEAKRLLETTSLGLEEVVT
RVGYEDVSSFRKLFIQLTSLTPRAYRQRFNTQQYEFDSDNCCEAELH