Protein Info for Shewana3_0055 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03486: HI0933_like" amino acids 4 to 392 (389 residues), 325.6 bits, see alignment E=8.3e-101 PF07992: Pyr_redox_2" amino acids 4 to 164 (161 residues), 32.9 bits, see alignment E=1.9e-11 PF00890: FAD_binding_2" amino acids 5 to 49 (45 residues), 36.1 bits, see alignment 1.8e-12 TIGR00275: flavoprotein, HI0933 family" amino acids 6 to 392 (387 residues), 432.6 bits, see alignment E=6.9e-134 PF13450: NAD_binding_8" amino acids 8 to 39 (32 residues), 23.7 bits, see alignment (E = 1.9e-08) PF22780: HI0933_like_1st" amino acids 189 to 339 (151 residues), 167.7 bits, see alignment E=8e-53

Best Hits

Swiss-Prot: 54% identical to Y933_HAEIN: Uncharacterized protein HI_0933 (HI_0933) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07007, (no description) (inferred from 99% identity to shm:Shewmr7_0047)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR81 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Shewana3_0055 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MKHHDVIIIGAGAAGLMCAATAGYRGRDVLVLDNAKQAGRKILISGGGRCNFTNLKVEPA
NFICGNPHFVKSALARYPSQQFIELVERHGIEYHERDHGQLFCNDSAKEIVTMLLTECEW
AGVSIKLRTDILAVSKTEAGRFELNTSNGELSCDSLVIATGGLSMPKLGATPYGYQLAEQ
FGLKVLPTHAGLVPFTWHSEDKIRFEPLSGIAVPSRITAKDGTAFSEALLFTHRGLSGPA
ILQISNYWKAGETIEINLLPNMDAAQAIEQQLAAHPKQSLRNTLSQWLPKRLVEVLFDEA
LLNKALNQLVHAERAKLVDDLHRWTVLMNGTEGYRTAEVTLGGVDTHELSSKTMEAIKVP
GLFFIGEVMDVSGWLGGFNFQWAWASGVAAGQAV