Protein Info for Shewana3_0045 in Shewanella sp. ANA-3

Annotation: carbonic anhydrase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF21711: DCTN5" amino acids 21 to 159 (139 residues), 36.2 bits, see alignment E=7.4e-13 PF14602: Hexapep_2" amino acids 80 to 112 (33 residues), 23 bits, see alignment 8e-09 amino acids 99 to 129 (31 residues), 18.3 bits, see alignment 2.3e-07 PF00132: Hexapep" amino acids 97 to 130 (34 residues), 29.8 bits, see alignment 5.4e-11

Best Hits

Swiss-Prot: 61% identical to YRDA_SHIFL: Protein YrdA (yrdA) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0045)

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR71 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Shewana3_0045 carbonic anhydrase (RefSeq) (Shewanella sp. ANA-3)
MSGPLRTYQGIHPQLGDNVYVDSASVLVGDIALDTDASIWPMVAARGDVNHIRIGKRSNV
QDGSILHVTRKFASRPDGHPLIIGDDVTIGHKAMLHGCKVGNRVLVGMGAIILDGAILED
DVILGAGSLVPPGKVLQSGYLYVGSPAKQARPLTEAELKFLPESADNYVRLKNEYLAEPQ
PE