Protein Info for Shewana3_0043 in Shewanella sp. ANA-3

Name: aroE
Annotation: shikimate 5-dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00507: shikimate dehydrogenase
  • amino acids 15 to 287 (273 residues), 282.4 bits, E=1.6e-88
• PF08501: Shikimate_dh_N
  • amino acids 17 to 99 (83 residues), 84.6 bits, E=7.1e-28
• PF01488: Shikimate_DH
  • amino acids 124 to 208 (85 residues), 40.9 bits, E=3.4e-14
• PF18317: SDH_C
  • amino acids 254 to 284 (31 residues), 39.1 bits, 7.5e-14

Best Hits

Swiss-Prot: 100% identical to AROE_SHESA: Shikimate dehydrogenase (NADP(+)) (aroE) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to shn:Shewana3_0043)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

See A0KR69 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Shewana3_0043 shikimate 5-dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MTDMPSVTTPALDRYAVFGNPIGHSKSPFIHGQFASLTQQTLSYEAILAPIDGFEASLRA
FFQAGGKGANVTVPFKEQAFALCDSLSAEATLAGAVNTLSLLADGTIYGDNTDGLGLVAD
LVRHLGSLQHKRVLLVGAGGAARGCILPLLKAEVGQLVITNRTQSKAQALVDIFSQVQEG
RYSDKLQAVSMSELSGVFDLVINSTSASLAGELPPLSQSIIGNKTACYDMMYGAKPTAFN
QWALQQGAAQVIDGLGMLVGQAAKSFALWRGVEPDTSGVLKLLRDKLQVDAQ