Protein Info for Shewana3_0033 in Shewanella sp. ANA-3

Annotation: sun protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF01029: NusB" amino acids 2 to 125 (124 residues), 94.9 bits, see alignment E=1.7e-30 TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase" amino acids 5 to 426 (422 residues), 458 bits, see alignment E=2e-141 PF22458: RsmF-B_ferredox" amino acids 142 to 212 (71 residues), 80.3 bits, see alignment E=2.9e-26 PF01189: Methyltr_RsmB-F" amino acids 234 to 424 (191 residues), 236.6 bits, see alignment E=6.3e-74 PF13847: Methyltransf_31" amino acids 242 to 376 (135 residues), 33.1 bits, see alignment E=1.4e-11 PF13649: Methyltransf_25" amino acids 245 to 316 (72 residues), 28 bits, see alignment E=8.9e-10

Best Hits

Swiss-Prot: 96% identical to RSMB_SHEON: Ribosomal RNA small subunit methyltransferase B (rsmB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to shn:Shewana3_0033)

Predicted SEED Role

"16S rRNA (cytosine(967)-C(5))-methyltransferase (EC 2.1.1.176)" (EC 2.1.1.176)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.176

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR59 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Shewana3_0033 sun protein (RefSeq) (Shewanella sp. ANA-3)
MMNLRALAAKAIFEVLEKGVSLSVALPEQQKHLASGKDKALLAELCYGVMRTLPQIEKRV
AECLAKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAEACRQLKFEGMVKVVNGVL
RNIQRQLTPLSTESETLSYNTPGWLIKRLKAAYPDNWQEIIQQSHERPPMWLRNNRLSQS
RDAYLAALSELEIEASAGLSDDAILLAHPKDVATLPRFHEGAASVQDGAAQWAATLLAPQ
ANELVLDACAAPGGKSCHLLELEPSIQLVAVDFDAKRLERVQQNLDRLSLKAEVIHGDAA
NIDSWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAELQRQILDHCWKWLK
PGGTLLYATCSILPQENRDQISAFLARTADAKLDTLAQQASSQDIGWQITPGQHNMDGFY
YARLLKATH