Protein Info for Shewana3_0027 in Shewanella sp. ANA-3

Annotation: TrkH family potassium uptake protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 134 to 160 (27 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 208 to 208 (1 residues), see Phobius details amino acids 210 to 225 (16 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 333 to 365 (33 residues), see Phobius details amino acids 398 to 420 (23 residues), see Phobius details amino acids 458 to 480 (23 residues), see Phobius details PF02386: TrkH" amino acids 37 to 479 (443 residues), 332.6 bits, see alignment E=1.8e-103 TIGR00933: potassium uptake protein, TrkH family" amino acids 83 to 468 (386 residues), 401.7 bits, see alignment E=1.8e-124

Best Hits

Swiss-Prot: 70% identical to TRKH_VIBPA: Trk system potassium uptake protein TrkH (trkH) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to shm:Shewmr7_0019)

MetaCyc: 66% identical to K+ transporter TrkH (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR53 at UniProt or InterPro

Protein Sequence (485 amino acids)

>Shewana3_0027 TrkH family potassium uptake protein (RefSeq) (Shewanella sp. ANA-3)
MQYKTIIRIIGLLIGLFSITMLPPALIAIWYNDGGGTAFIQAFFVSLFIGFWLWYPNRRC
KEELRTREGFLIVVLFWTVLGSIGALPFIFSSQPDLSWTDSFFESFSALTTTGATVIVGL
DSLPKAILFYRHMLQWLGGMGIIVLAVAILPVLGVGGMQLYRAEIPGPVKDSKMTPRIAE
TAKALWYIYLLLTIACAGAYWLAGMSVFDAVCHSFSTIAIGGFSTHDASMGYFDSSVINL
ICVFFLIVSAVNFSVHFAAFSRRGINFRVYFRDTEFKMLVAIQLVLTAICFLTLYHSGIY
DSPEETLDHALFQAVSVATTAGFGTESFHMWPLFLPILLIFSSFIGGCGGSTAGGIKVIR
VILLLLQGSRELKRLVHPKAMFSIRIGSKALPDRVVDAVWGFFSAYALVFVLCMLALMAM
GLDDITAFSATAACLNNLGPGLGEVASNYASIGDGAKWVLVVAMLFGRLEVFTLLILFTP
TFWRD