Protein Info for Shewana3_0026 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR00257: uncharacterized protein, YigZ family" amino acids 1 to 198 (198 residues), 204.2 bits, see alignment E=7.9e-65 PF01205: Impact_N" amino acids 19 to 124 (106 residues), 109.7 bits, see alignment E=7.3e-36 PF09186: DUF1949" amino acids 143 to 196 (54 residues), 41.8 bits, see alignment E=8.2e-15

Best Hits

Swiss-Prot: 44% identical to Y722_HAEIN: IMPACT family member HI_0722 (HI_0722) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0026)

Predicted SEED Role

"FIG000605: protein co-occurring with transport systems (COG1739)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KR52 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Shewana3_0026 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MLESYLIPSESVQIEEEIKHSRFISFLFHCTSLEQLKLVLTDIKRDYPGASHYCYAFIAG
APNDSIAIGSSDDGEPAGSAGRPMLAVLQGANLGEVGAVVVRFYGGTKLGVGGLVRAYTS
GLRQGLGQLPTRVKQLRYPAKQHCDYTQLRDVEHLLQQLEAVIIDKQFAEAVDIHFEIGK
QQQGILNESLATLSQGSLRAEFEL